| Class b: All beta proteins [48724] (176 folds) |
| Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
| Family b.22.1.0: automated matches [191519] (1 protein) not a true family |
| Protein automated matches [190873] (3 species) not a true protein |
| Species Mus musculus [TaxId:10090] [271469] (6 PDB entries) |
| Domain d4qqoa_: 4qqo A: [271692] automated match to d2ka3a_ complexed with mg; mutant |
PDB Entry: 4qqo (more details), 2.03 Å
SCOPe Domain Sequences for d4qqoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qqoa_ b.22.1.0 (A:) automated matches {Mus musculus [TaxId: 10090]}
kiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdgt
smwadlcknnqvrasaiaqaadqnydyasnsvvlhlepgdevyikldggkahggnnnkys
tfsgfiiyad
Timeline for d4qqoa_: