Lineage for d4qf9b1 (4qf9 B:3-118,B:119-254)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913863Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2914271Species Norway rat (Rattus norvegicus), GluR5 [TaxId:10116] [142802] (5 PDB entries)
    Uniprot P22756 429-546,667-799! Uniprot P22756 433-544,682-815
  8. 2914276Domain d4qf9b1: 4qf9 B:3-118,B:119-254 [271689]
    automated match to d1ycja1
    complexed with 35k, act, cl, gol, pg4, so4

Details for d4qf9b1

PDB Entry: 4qf9 (more details), 2.28 Å

PDB Description: structure of gluk1 ligand-binding domain (s1s2) in complex with (s)-2- amino-4-(2,3-dioxo-1,2,3,4-tetrahydroquinoxalin-6-yl)butanoic acid at 2.28 a resolution
PDB Compounds: (B:) Glutamate receptor ionotropic, kainate 1

SCOPe Domain Sequences for d4qf9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qf9b1 c.94.1.1 (B:3-118,B:119-254) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR5 [TaxId: 10116]}
nrtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkyg
aqndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtXpid
saddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvl
ttdyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeeg
klhmmkekwwrgn

SCOPe Domain Coordinates for d4qf9b1:

Click to download the PDB-style file with coordinates for d4qf9b1.
(The format of our PDB-style files is described here.)

Timeline for d4qf9b1: