| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (46 species) not a true protein |
| Species Ralstonia eutropha [TaxId:381666] [271667] (3 PDB entries) |
| Domain d4pzeh2: 4pze H:186-284 [271684] Other proteins in same PDB: d4pzea1, d4pzeb1, d4pzec1, d4pzed1, d4pzee1, d4pzef1, d4pzeg1, d4pzeh1, d4pzei1 automated match to d4kuga2 complexed with caa |
PDB Entry: 4pze (more details), 2.7 Å
SCOPe Domain Sequences for d4pzeh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pzeh2 a.100.1.0 (H:186-284) automated matches {Ralstonia eutropha [TaxId: 381666]}
gfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtmlavme
vlytefadpkyrpamlmremvaagylgrktgrgvyvysk
Timeline for d4pzeh2: