Lineage for d4pzeh1 (4pze H:2-185)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831994Species Ralstonia eutropha [TaxId:381666] [229715] (6 PDB entries)
  8. 1832014Domain d4pzeh1: 4pze H:2-185 [271683]
    Other proteins in same PDB: d4pzea2, d4pzeb2, d4pzec2, d4pzed2, d4pzee2, d4pzef2, d4pzeg2, d4pzeh2, d4pzei2
    automated match to d4kuea1
    complexed with caa

Details for d4pzeh1

PDB Entry: 4pze (more details), 2.7 Å

PDB Description: crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa
PDB Compounds: (H:) 3-hydroxyacyl-CoA dehydrogenase

SCOPe Domain Sequences for d4pzeh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pzeh1 c.2.1.0 (H:2-185) automated matches {Ralstonia eutropha [TaxId: 381666]}
sirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklte
adkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntssi
sitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypitv
knsp

SCOPe Domain Coordinates for d4pzeh1:

Click to download the PDB-style file with coordinates for d4pzeh1.
(The format of our PDB-style files is described here.)

Timeline for d4pzeh1: