SCOPe 2.05: Domain d4pzee2: 4pze E:186-284

Lineage for d4pzee2 (4pze E:186-284)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (30 species)
   not a true protein

7. Species Ralstonia eutropha [TaxId:381666] [271667] (1 PDB entry)

8. Domain d4pzee2: 4pze E:186-284 [271680]
   Other proteins in same PDB: d4pzea1, d4pzeb1, d4pzec1, d4pzed1, d4pzee1, d4pzef1, d4pzeg1, d4pzeh1, d4pzei1
   automated match to d4kuga2
   complexed with caa

Details for d4pzee2

PDB Entry: 4pze, 2.7 Å

PDB Description: crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa

PDB Compounds: (E:) 3-hydroxyacyl-CoA dehydrogenase

SCOPe Domain Sequences for d4pzee2:

Sequence; same for both SEQRES and ATOM records:

>d4pzee2 a.100.1.0 (E:186-284) automated matches {Ralstonia eutropha [TaxId: 381666]}
gfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtmlavme
vlytefadpkyrpamlmremvaagylgrktgrgvyvysk

Timeline for d4pzee2:

• d4pzee2 is new in SCOPe 2.05-stable
  
• d4pzee2 appears in SCOPe 2.06
  
• d4pzee2 appears in the current release, SCOPe 2.08