Lineage for d4pzeb2 (4pze B:186-284)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721912Species Ralstonia eutropha [TaxId:381666] [271667] (3 PDB entries)
  8. 2721926Domain d4pzeb2: 4pze B:186-284 [271676]
    Other proteins in same PDB: d4pzea1, d4pzeb1, d4pzec1, d4pzed1, d4pzee1, d4pzef1, d4pzeg1, d4pzeh1, d4pzei1
    automated match to d4kuga2
    complexed with caa

Details for d4pzeb2

PDB Entry: 4pze (more details), 2.7 Å

PDB Description: crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa
PDB Compounds: (B:) 3-hydroxyacyl-CoA dehydrogenase

SCOPe Domain Sequences for d4pzeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pzeb2 a.100.1.0 (B:186-284) automated matches {Ralstonia eutropha [TaxId: 381666]}
gfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtmlavme
vlytefadpkyrpamlmremvaagylgrktgrgvyvysk

SCOPe Domain Coordinates for d4pzeb2:

Click to download the PDB-style file with coordinates for d4pzeb2.
(The format of our PDB-style files is described here.)

Timeline for d4pzeb2: