| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Ralstonia eutropha [TaxId:381666] [229715] (8 PDB entries) |
| Domain d4pzeb1: 4pze B:2-185 [271673] Other proteins in same PDB: d4pzea2, d4pzeb2, d4pzec2, d4pzed2, d4pzee2, d4pzef2, d4pzeg2, d4pzeh2, d4pzei2 automated match to d4kuea1 complexed with caa |
PDB Entry: 4pze (more details), 2.7 Å
SCOPe Domain Sequences for d4pzeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pzeb1 c.2.1.0 (B:2-185) automated matches {Ralstonia eutropha [TaxId: 381666]}
sirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklte
adkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntssi
sitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypitv
knsp
Timeline for d4pzeb1: