Lineage for d4pzeb1 (4pze B:2-185)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848232Species Ralstonia eutropha [TaxId:381666] [229715] (8 PDB entries)
  8. 2848258Domain d4pzeb1: 4pze B:2-185 [271673]
    Other proteins in same PDB: d4pzea2, d4pzeb2, d4pzec2, d4pzed2, d4pzee2, d4pzef2, d4pzeg2, d4pzeh2, d4pzei2
    automated match to d4kuea1
    complexed with caa

Details for d4pzeb1

PDB Entry: 4pze (more details), 2.7 Å

PDB Description: crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa
PDB Compounds: (B:) 3-hydroxyacyl-CoA dehydrogenase

SCOPe Domain Sequences for d4pzeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pzeb1 c.2.1.0 (B:2-185) automated matches {Ralstonia eutropha [TaxId: 381666]}
sirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklte
adkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntssi
sitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypitv
knsp

SCOPe Domain Coordinates for d4pzeb1:

Click to download the PDB-style file with coordinates for d4pzeb1.
(The format of our PDB-style files is described here.)

Timeline for d4pzeb1: