Lineage for d1eqda_ (1eqd A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2413761Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2414133Protein Nitrophorin 4 [50845] (1 species)
  7. 2414134Species Rhodnius prolixus [TaxId:13249] [50846] (49 PDB entries)
    Uniprot Q94734 22-205
  8. 2414183Domain d1eqda_: 1eqd A: [27167]
    complexed with cit, cyn, hev

Details for d1eqda_

PDB Entry: 1eqd (more details), 1.6 Å

PDB Description: crystal structure of nitrophorin 4 complexed with cn
PDB Compounds: (A:) Nitrophorin 4

SCOPe Domain Sequences for d1eqda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqda_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

SCOPe Domain Coordinates for d1eqda_:

Click to download the PDB-style file with coordinates for d1eqda_.
(The format of our PDB-style files is described here.)

Timeline for d1eqda_: