Lineage for d4pcra_ (4pcr A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778280Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 2778281Species Brazilian jackbean (Canavalia brasiliensis) [TaxId:61861] [49903] (7 PDB entries)
  8. 2778287Domain d4pcra_: 4pcr A: [271665]
    automated match to d1azda_
    complexed with abu, ca, edo, ipa, mn, peg

Details for d4pcra_

PDB Entry: 4pcr (more details), 2.15 Å

PDB Description: crystal structure of canavalia brasiliensis seed lectin (conbr) complexed with gamma-aminobutyric acid (gaba)
PDB Compounds: (A:) Concanavalin-Br

SCOPe Domain Sequences for d4pcra_:

Sequence, based on SEQRES records: (download)

>d4pcra_ b.29.1.1 (A:) Concanavalin A {Brazilian jackbean (Canavalia brasiliensis) [TaxId: 61861]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtegnlrltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d4pcra_ b.29.1.1 (A:) Concanavalin A {Brazilian jackbean (Canavalia brasiliensis) [TaxId: 61861]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
nalhfmfnqfskdqkdlilqgdattgtegnlrltrvssngspqgssvgralfyapvhiwe
ssavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d4pcra_:

Click to download the PDB-style file with coordinates for d4pcra_.
(The format of our PDB-style files is described here.)

Timeline for d4pcra_: