Lineage for d4pcfb_ (4pcf B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089715Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2089716Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2090066Protein automated matches [196175] (7 species)
    not a true protein
  7. 2090086Species Trypanosoma brucei [TaxId:5702] [271658] (9 PDB entries)
  8. 2090111Domain d4pcfb_: 4pcf B: [271661]
    automated match to d1tpfa_

Details for d4pcfb_

PDB Entry: 4pcf (more details), 2.71 Å

PDB Description: structure-based protein engineering of a monomeric triosephosphate isomerase towards changing substrate specificity
PDB Compounds: (B:) Ma18-TIM

SCOPe Domain Sequences for d4pcfb_:

Sequence, based on SEQRES records: (download)

>d4pcfb_ c.1.1.1 (B:) automated matches {Trypanosoma brucei [TaxId: 5702]}
skpqpiaaanwksgspdslsglidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
aaqnagntdalaslkdfgvnwivlghferrwyygetneivadkvaaavasgfmviacige
tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvvtpqqaqeahal
irswvsskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikat

Sequence, based on observed residues (ATOM records): (download)

>d4pcfb_ c.1.1.1 (B:) automated matches {Trypanosoma brucei [TaxId: 5702]}
skpqpiaaanwksspdslsglidlfnstsinhdvqcvvastfvhlamtkerlshpkfvia
aqnagntdalaslkdfgvnwivlghferrwyygetneivadkvaaavasgfmviaciget
lqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvvtpqqaqeahali
rswvsskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikat

SCOPe Domain Coordinates for d4pcfb_:

Click to download the PDB-style file with coordinates for d4pcfb_.
(The format of our PDB-style files is described here.)

Timeline for d4pcfb_: