| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
| Protein automated matches [226842] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
| Domain d4ozgd1: 4ozg D:3-92 [271656] Other proteins in same PDB: d4ozga2, d4ozgb2, d4ozgc2, d4ozgd2, d4ozge1, d4ozge2, d4ozgf1, d4ozgf2, d4ozgg1, d4ozgg2, d4ozgh1, d4ozgh2 automated match to d1klub2 complexed with ca, nag |
PDB Entry: 4ozg (more details), 3 Å
SCOPe Domain Sequences for d4ozgd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ozgd1 d.19.1.0 (D:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
sqkdilerkraavdrvcrhnyqlelrttlq
Timeline for d4ozgd1: