Lineage for d4ozgd1 (4ozg D:3-92)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (67 PDB entries)
  8. 2507681Domain d4ozgd1: 4ozg D:3-92 [271656]
    Other proteins in same PDB: d4ozga2, d4ozgb2, d4ozgc2, d4ozgd2, d4ozge1, d4ozge2, d4ozgf1, d4ozgf2, d4ozgg1, d4ozgg2, d4ozgh1, d4ozgh2
    automated match to d1klub2
    complexed with ca, nag

Details for d4ozgd1

PDB Entry: 4ozg (more details), 3 Å

PDB Description: d2 protein complex
PDB Compounds: (D:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d4ozgd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ozgd1 d.19.1.0 (D:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
sqkdilerkraavdrvcrhnyqlelrttlq

SCOPe Domain Coordinates for d4ozgd1:

Click to download the PDB-style file with coordinates for d4ozgd1.
(The format of our PDB-style files is described here.)

Timeline for d4ozgd1: