SCOPe 2.05: Domain d4ozgg2: 4ozg G:130-217

Lineage for d4ozgg2 (4ozg G:130-217)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries)

8. Domain d4ozgg2: 4ozg G:130-217 [271655]
   Other proteins in same PDB: d4ozga1, d4ozgb1, d4ozgb2, d4ozgc1, d4ozgd1, d4ozgd2, d4ozgg1
   automated match to d2pyfa2
   complexed with ca, nag

Details for d4ozgg2

PDB Entry: 4ozg, 3 Å

PDB Description: d2 protein complex

PDB Compounds: (G:) T-cell receptor, d2, alpha chain

SCOPe Domain Sequences for d4ozgg2:

Sequence, based on SEQRES records:

>d4ozgg2 b.1.1.2 (G:130-217) automated matches {Homo sapiens [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records):

>d4ozgg2 b.1.1.2 (G:130-217) automated matches {Homo sapiens [TaxId: 9606]}
iqnpdpavyqlrdsdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
wsnksdfacanafnnsiipedtffp

Timeline for d4ozgg2:

• d4ozgg2 is new in SCOPe 2.05-stable
  
• d4ozgg2 appears in SCOPe 2.06
  
• d4ozgg2 appears in the current release, SCOPe 2.08