SCOPe 2.08: Domain d4ozgb1: 4ozg B:3-92

Lineage for d4ozgb1 (4ozg B:3-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d4ozgb1: 4ozg B:3-92 [271650]
   Other proteins in same PDB: d4ozga2, d4ozgb2, d4ozgc2, d4ozgd2, d4ozge1, d4ozge2, d4ozgf1, d4ozgf2, d4ozgg1, d4ozgg2, d4ozgh1, d4ozgh2
   automated match to d1klub2
   complexed with ca, nag

Details for d4ozgb1

PDB Entry: 4ozg, 3 Å

PDB Description: d2 protein complex

PDB Compounds: (B:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d4ozgb1:

Sequence; same for both SEQRES and ATOM records:

>d4ozgb1 d.19.1.0 (B:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
sqkdilerkraavdrvcrhnyqlelrttlq

Timeline for d4ozgb1:

• d4ozgb1 first appeared in SCOPe 2.05
  
• d4ozgb1 appears in SCOPe 2.07