SCOPe 2.05: Domain d3nfwb_: 3nfw B:

Lineage for d3nfwb_ (3nfw B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.0: automated matches [191365] (1 protein)
   not a true family

6. Protein automated matches [190439] (19 species)
   not a true protein

7. Species Mycobacterium thermoresistibile [TaxId:1078020] [267858] (1 PDB entry)

8. Domain d3nfwb_: 3nfw B: [271646]
   automated match to d3nfwa_
   complexed with gol

Details for d3nfwb_

PDB Entry: 3nfw, 1.6 Å

PDB Description: crystal structure of nitrilotriacetate monooxygenase component b (a0r521 homolog) from mycobacterium thermoresistibile

PDB Compounds: (B:) Flavin reductase-like, FMN-binding protein

SCOPe Domain Sequences for d3nfwb_:

Sequence; same for both SEQRES and ATOM records:

>d3nfwb_ b.45.1.0 (B:) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
vtaeaidqrtfrrvlgqfctgvtiittvhegnpvgfacqsfaalsldpplvlfcptkvsr
swkaieasgrfcvnilhekqqhvsarfgsrepdkfagidwrpsdlgspiidgslahidct
vhdvhdggdhfvvfgkvhglsevperkprpllfyrgeytgiepekntpaqwrddleaflt
at

Timeline for d3nfwb_:

• d3nfwb_ is new in SCOPe 2.05-stable
  
• d3nfwb_ is called d3nfwb1 in SCOPe 2.06
  
• d3nfwb_ appears in the current release, SCOPe 2.08, called d3nfwb1