SCOPe 2.05: Domain d2mo5a_: 2mo5 A:

Lineage for d2mo5a_ (2mo5 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (24 PDB entries)

8. Domain d2mo5a_: 2mo5 A: [271637]
   automated match to d1g7na_
   complexed with ola

Details for d2mo5a_

PDB Entry: 2mo5

PDB Description: hifabp-oleate complex

PDB Compounds: (A:) Fatty acid-binding protein, intestinal

SCOPe Domain Sequences for d2mo5a_:

Sequence; same for both SEQRES and ATOM records:

>d2mo5a_ b.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ahhhhhhvgtqafdstwkvdrsenydkfmekmgvnivkrklaahdnlkltitqegnkftv
kessafrnievvfelgvtfnynladgtelrgtwslegnkligkfkrtdngnelntvreii
gdelvqtyvyegveakrifkkd

Timeline for d2mo5a_:

• d2mo5a_ is new in SCOPe 2.05-stable
  
• d2mo5a_ is called d2mo5a1 in SCOPe 2.06
  
• d2mo5a_ appears in the current release, SCOPe 2.08, called d2mo5a1