Lineage for d4cvka3 (4cvk A:320-451)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498723Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 2498724Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) (S)
  5. 2498767Family c.59.1.0: automated matches [254241] (1 protein)
    not a true family
  6. 2498768Protein automated matches [254550] (5 species)
    not a true protein
  7. 2498783Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271628] (3 PDB entries)
  8. 2498784Domain d4cvka3: 4cvk A:320-451 [271631]
    Other proteins in same PDB: d4cvka1, d4cvka2
    automated match to d1gg4a1
    complexed with ala, api, fga, mub, udp

Details for d4cvka3

PDB Entry: 4cvk (more details), 1.92 Å

PDB Description: pamurf in complex with udp-murnac-tripeptide (mdap)
PDB Compounds: (A:) udp-n-acetylmuramoyl-tripeptide--d-alanyl-d-alanine ligase

SCOPe Domain Sequences for d4cvka3:

Sequence, based on SEQRES records: (download)

>d4cvka3 c.59.1.0 (A:320-451) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
vkgravaqltasglrviddsynanpasmlaaidilsgfsgrtvlvlgdmgelgswaeqah
revgayaagkvsalyavgplmahavqafgatgrhfadqasligalatedptttilikgsr
saamdkvvaalc

Sequence, based on observed residues (ATOM records): (download)

>d4cvka3 c.59.1.0 (A:320-451) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
vkgravaqltasglrviddsynanpasmlaaidilsgfsgrtvlvlgdmgaeqahrevga
yaagkvsalyavgplmahavqafgatgrhfadqasligalatedptttilikgsrsaamd
kvvaalc

SCOPe Domain Coordinates for d4cvka3:

Click to download the PDB-style file with coordinates for d4cvka3.
(The format of our PDB-style files is described here.)

Timeline for d4cvka3: