Lineage for d1euoa_ (1euo A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1799772Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1800049Protein Nitrophorin 2 (prolixin-s) [50843] (1 species)
  7. 1800050Species Rhodnius prolixus [TaxId:13249] [50844] (14 PDB entries)
    Uniprot Q26241
  8. 1800064Domain d1euoa_: 1euo A: [27163]
    complexed with hem, nh3

Details for d1euoa_

PDB Entry: 1euo (more details), 2 Å

PDB Description: crystal structure of nitrophorin 2 (prolixin-s)
PDB Compounds: (A:) Nitrophorin 2

SCOPe Domain Sequences for d1euoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euoa_ b.60.1.1 (A:) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]}
mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn
ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh
iclregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl

SCOPe Domain Coordinates for d1euoa_:

Click to download the PDB-style file with coordinates for d1euoa_.
(The format of our PDB-style files is described here.)

Timeline for d1euoa_: