SCOPe 2.07: Domain d4cvla3: 4cvl A:320-451

Lineage for d4cvla3 (4cvl A:320-451)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest

4. Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families)

5. Family c.59.1.0: automated matches [254241] (1 protein)
   not a true family

6. Protein automated matches [254550] (5 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271628] (3 PDB entries)

8. Domain d4cvla3: 4cvl A:320-451 [271629]
   Other proteins in same PDB: d4cvla1, d4cvla2
   automated match to d1gg4a1
   complexed with acp, mg

Details for d4cvla3

PDB Entry: 4cvl, 2.98 Å

PDB Description: pamurf in complex with amp-pnp

PDB Compounds: (A:) udp-n-acetylmuramoyl-tripeptide--d-alanyl-d-alanine ligase

SCOPe Domain Sequences for d4cvla3:

Sequence, based on SEQRES records:

>d4cvla3 c.59.1.0 (A:320-451) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
vkgravaqltasglrviddsynanpasmlaaidilsgfsgrtvlvlgdmgelgswaeqah
revgayaagkvsalyavgplmahavqafgatgrhfadqasligalatedptttilikgsr
saamdkvvaalc

Sequence, based on observed residues (ATOM records):

>d4cvla3 c.59.1.0 (A:320-451) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
vkgravaqltasglrviddspasmlaaidilsgfsgrtvlvlgdmgaeqahrevgayaag
kvsalyavgplmahavqafgatgrhfadqasligalatedptttilikgsrsaamdkvva
alc

Timeline for d4cvla3:

• d4cvla3 first appeared in SCOPe 2.05
  
• d4cvla3 appears in SCOPe 2.06
  
• d4cvla3 appears in the current release, SCOPe 2.08