Lineage for d4cvma1 (4cvm A:1-100)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526235Fold c.98: MurF and HprK N-domain-like [63417] (2 superfamilies)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1234; structural similarity of the MurF and HprK extends beyond the core.
  4. 2526236Superfamily c.98.1: MurE/MurF N-terminal domain [63418] (2 families) (S)
    binds UDP group
  5. 2526246Family c.98.1.0: automated matches [271609] (1 protein)
    not a true family
  6. 2526247Protein automated matches [271613] (1 species)
    not a true protein
  7. 2526248Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271617] (3 PDB entries)
  8. 2526250Domain d4cvma1: 4cvm A:1-100 [271626]
    Other proteins in same PDB: d4cvma2, d4cvma3
    automated match to d1gg4a3
    complexed with ala, anp, fga, mg, mub, udp

Details for d4cvma1

PDB Entry: 4cvm (more details), 2.06 Å

PDB Description: pamurf in complex with amp-pnp and udp-murnac-tripeptide (mdap)
PDB Compounds: (A:) udp-n-acetylmuramoyl-tripeptide--d-alanyl-d- alanine ligase

SCOPe Domain Sequences for d4cvma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cvma1 c.98.1.0 (A:1-100) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mleplrlsqltvaldarligedavfsavstdsraigpgelfialsgprfdghdylaevaa
kgavaalverevadaplpqllvrdtraalgrlgalnrrkf

SCOPe Domain Coordinates for d4cvma1:

Click to download the PDB-style file with coordinates for d4cvma1.
(The format of our PDB-style files is described here.)

Timeline for d4cvma1: