SCOPe 2.07: Domain d4cvla1: 4cvl A:1-100

Lineage for d4cvla1 (4cvl A:1-100)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.98: MurF and HprK N-domain-like [63417] (2 superfamilies)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1234; structural similarity of the MurF and HprK extends beyond the core.

4. Superfamily c.98.1: MurE/MurF N-terminal domain [63418] (2 families)
   binds UDP group

5. Family c.98.1.0: automated matches [271609] (1 protein)
   not a true family

6. Protein automated matches [271613] (1 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271617] (3 PDB entries)

8. Domain d4cvla1: 4cvl A:1-100 [271622]
   Other proteins in same PDB: d4cvla2, d4cvla3
   automated match to d1gg4a3
   complexed with acp, mg

Details for d4cvla1

PDB Entry: 4cvl, 2.98 Å

PDB Description: pamurf in complex with amp-pnp

PDB Compounds: (A:) udp-n-acetylmuramoyl-tripeptide--d-alanyl-d-alanine ligase

SCOPe Domain Sequences for d4cvla1:

Sequence, based on SEQRES records:

>d4cvla1 c.98.1.0 (A:1-100) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mleplrlsqltvaldarligedavfsavstdsraigpgelfialsgprfdghdylaevaa
kgavaalverevadaplpqllvrdtraalgrlgalnrrkf

Sequence, based on observed residues (ATOM records):

>d4cvla1 c.98.1.0 (A:1-100) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mleplrlsqltvaldarligedavfsavstdsraigpgelfialsdghdylaevaakgav
aalvereaplpqllvrdtraalgrlgalnrrkf

Timeline for d4cvla1:

• d4cvla1 first appeared in SCOPe 2.05
  
• d4cvla1 appears in SCOPe 2.06
  
• d4cvla1 appears in the current release, SCOPe 2.08