Lineage for d5ak2a1 (5ak2 A:307-552)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2009679Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2009680Protein automated matches [191142] (6 species)
    not a true protein
  7. 2009693Species Human (Homo sapiens) [TaxId:9606] [189274] (53 PDB entries)
  8. 2009712Domain d5ak2a1: 5ak2 A:307-552 [271607]
    Other proteins in same PDB: d5ak2a2
    automated match to d2pjla_
    complexed with 85z

Details for d5ak2a1

PDB Entry: 5ak2 (more details), 2.19 Å

PDB Description: oxyphenylpropenoic acids as oral selective estrogen receptor down-regulators.
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d5ak2a1:

Sequence, based on SEQRES records: (download)

>d5ak2a1 a.123.1.0 (A:307-552) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemlda
hrlhap

Sequence, based on observed residues (ATOM records): (download)

>d5ak2a1 a.123.1.0 (A:307-552) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilysesmmglltnladrelvhminwakrvpgfvdltlhdqv
hllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllatssrfr
mmnlqgeefvclksiillnsgvytsleekdhihrvldkitdtlihlmakagltlqqqhqr
laqlllilshirhmsnkgmehlysmvpsydlllemldahrlhap

SCOPe Domain Coordinates for d5ak2a1:

Click to download the PDB-style file with coordinates for d5ak2a1.
(The format of our PDB-style files is described here.)

Timeline for d5ak2a1:

  • d5ak2a1 first appeared in SCOPe 2.05, called d5ak2a_

View in 3D
Domains from same chain:
(mouse over for more information)
d5ak2a2
View in 3D
Domains from other chains:
(mouse over for more information)
d5ak2b_