Lineage for d4z0na_ (4z0n A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913163Protein automated matches [190296] (11 species)
    not a true protein
  7. 2913221Species Streptobacillus moniliformis [TaxId:519441] [271603] (1 PDB entry)
  8. 2913222Domain d4z0na_: 4z0n A: [271604]
    automated match to d2gbpa_
    complexed with act, ca, edo, gal, na, so4

Details for d4z0na_

PDB Entry: 4z0n (more details), 1.26 Å

PDB Description: crystal structure of a periplasmic solute binding protein (ipr025997) from streptobacillus moniliformis dsm-12112 (smon_0317, target efi- 511281) with bound d-galactose
PDB Compounds: (A:) Periplasmic binding protein/LacI transcriptional regulator

SCOPe Domain Sequences for d4z0na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z0na_ c.93.1.1 (A:) automated matches {Streptobacillus moniliformis [TaxId: 519441]}
kitlgvtyykfddnflagmrndmiqiakekypniellnndsqnsqsilndqievlinkgv
nvlvinlvdptagqsvidkakaanipiilfnkdpgvdalnsydkawyvgttpkdsgilqg
qviekawlanpaydlngdgviqyvmlfgepgqpdaeartkysieylnekgikteelhkdi
anwdaaqakdkmdawlsgpnankievvianndgmalgavesikavkkelpvfgvdaiqea
ltliekgemvgtvlqdatgqarailelanniangkeptegtewklidkavrvpyvgvdkd
nykefqk

SCOPe Domain Coordinates for d4z0na_:

Click to download the PDB-style file with coordinates for d4z0na_.
(The format of our PDB-style files is described here.)

Timeline for d4z0na_: