Lineage for d4yn0b_ (4yn0 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714459Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 2714523Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (2 families) (S)
    the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold (46965)
  5. 2714537Family a.47.4.0: automated matches [191661] (1 protein)
    not a true family
  6. 2714538Protein automated matches [191241] (2 species)
    not a true protein
  7. 2714553Species Mouse (Mus musculus) [TaxId:10090] [271601] (1 PDB entry)
  8. 2714554Domain d4yn0b_: 4yn0 B: [271602]
    automated match to d3q7ga_
    complexed with mg, nag

Details for d4yn0b_

PDB Entry: 4yn0 (more details), 2.2 Å

PDB Description: crystal structure of app e2 domain in complex with dr6 crd domain
PDB Compounds: (B:) amyloid beta a4 protein

SCOPe Domain Sequences for d4yn0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yn0b_ a.47.4.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tpgdenehahfqkakerleakhrermsqvmreweeaerqaknlpkadkkaviqhfqekve
sleqeaanerqqlvethmarveamlndrrrlalenyitalqavpprphhvfnmlkkyvra
eqkdrqhtlkhfehvrmvdpkkaaqirsqvmthlrviyermnqslsllynvpavaeeiqd
evdellqkeqnysddvlanmis

SCOPe Domain Coordinates for d4yn0b_:

Click to download the PDB-style file with coordinates for d4yn0b_.
(The format of our PDB-style files is described here.)

Timeline for d4yn0b_: