SCOPe 2.05: Domain d4yetb2: 4yet B:84-199

Lineage for d4yetb2 (4yet B:84-199)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (30 species)
   not a true protein

7. Species Babesia bovis [TaxId:5865] [226663] (2 PDB entries)

8. Domain d4yetb2: 4yet B:84-199 [271600]
   Other proteins in same PDB: d4yeta1, d4yetb1
   automated match to d4k2wa2
   complexed with fe

Details for d4yetb2

PDB Entry: 4yet, 1.75 Å

PDB Description: x-ray crystal structure of superoxide dismutase from babesia bovis solved by sulfur sad

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d4yetb2:

Sequence; same for both SEQRES and ATOM records:

>d4yetb2 d.44.1.0 (B:84-199) automated matches {Babesia bovis [TaxId: 5865]}
ncggeptgpirkkieekfgsfsafktdfsnllaghfgsgwgwlvlkddgtadivqthdag
splkenlgrpllccdvwehayyidykndrlsyinswwnlvnwdfanknleapfkws

Timeline for d4yetb2:

• d4yetb2 is new in SCOPe 2.05-stable
  
• d4yetb2 appears in SCOPe 2.06
  
• d4yetb2 appears in the current release, SCOPe 2.08