Lineage for d4yetb1 (4yet B:0-83)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1719057Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1719324Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 1719325Protein automated matches [226859] (31 species)
    not a true protein
  7. 1719354Species Babesia bovis [TaxId:5865] [226662] (2 PDB entries)
  8. 1719358Domain d4yetb1: 4yet B:0-83 [271599]
    Other proteins in same PDB: d4yeta2, d4yetb2
    automated match to d4k2wa1
    complexed with fe

Details for d4yetb1

PDB Entry: 4yet (more details), 1.75 Å

PDB Description: x-ray crystal structure of superoxide dismutase from babesia bovis solved by sulfur sad
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d4yetb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yetb1 a.2.11.0 (B:0-83) automated matches {Babesia bovis [TaxId: 5865]}
smafklpalpygmreliphiseetlsfhygkhhagyvnklnslikgtpmesctieelilg
qtgavfnnaaqiwnhtfywnsmgp

SCOPe Domain Coordinates for d4yetb1:

Click to download the PDB-style file with coordinates for d4yetb1.
(The format of our PDB-style files is described here.)

Timeline for d4yetb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yetb2