SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4y8wb1 (4y8w B:30-484)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (54 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005690Domain d4y8wb1: 4y8w B:30-484 [271591]
    Other proteins in same PDB: d4y8wa2, d4y8wb2, d4y8wc2
    automated match to d2vn0a_
    complexed with hem, so4, str

Details for d4y8wb1

PDB Entry: 4y8w (more details), 2.64 Å

PDB Description: crystal structure of human cytochrome p450 21a2 progesterone complex
PDB Compounds: (B:) Cytochrome P450 21-hydroxylase

SCOPe Domain Sequences for d4y8wb1:

Sequence, based on SEQRES records: (download)

>d4y8wb1 a.104.1.0 (B:30-484) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpplapgflhllqpdlpiyllgltqkfgpiyrlhlglqdvvvlnskrtieeamvkkwadf
agrpepltyklvsrnypdlslgdysllwkahkkltrsalllgirdsmepvveqltqefce
rmraqpgtpvaieeefslltcsiicyltfgdkikddnlmpayykciqevlktwshwsiqi
vdvipflrffpnpglrrlkqaiekrdhivemqlrqhkeslvagqwrdmmdymlqgvaqps
meegsgqlleghvhmaavdlliggtettantlswavvfllhhpeiqqrlqeeldhelgpg
asssrvpykdrarlpllnatiaevlrlrpvvplalphrttrpssisgydipegtviipnl
qgahldetvwerphefwpdrflepgknsralafgcgarvclgeplarlelfvvltrllqa
ftllpsgdalpslqplphcsvilkmqpfqvrlqpr

Sequence, based on observed residues (ATOM records): (download)

>d4y8wb1 a.104.1.0 (B:30-484) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpplapgflhllqpdlpiyllgltqkfgpiyrlhlglqdvvvlnskrtieeamvkkwadf
agrpepltyklvsrnypdlslgdysllwkahkkltrsalllgirdsmepvveqltqefce
rmraqpgtpvaieeefslltcsiicyltfgdkikddnlmpayykciqevlktwshwsiqi
vdvipflrffpnpglrrlkqaiekrdhivemqlrqhkeslvagqwrdmmdymlqgvaqql
leghvhmaavdlliggtettantlswavvfllhhpeiqqrlqeeldhsrvpykdrarlpl
lnatiaevlrlrpvvplalphrttrpssisgydipegtviipnlqgahldetvwerphef
wpdrflepgknsralafgcgarvclgeplarlelfvvltrllqaftllpsgdalpslqpl
phcsvilkmqpfqvrlqpr

SCOPe Domain Coordinates for d4y8wb1:

Click to download the PDB-style file with coordinates for d4y8wb1.
(The format of our PDB-style files is described here.)

Timeline for d4y8wb1:

  • d4y8wb1 first appeared in SCOPe 2.05, called d4y8wb_