Lineage for d4y8wb1 (4y8w B:30-484)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (61 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005690Domain d4y8wb1: 4y8w B:30-484 [271591]
    Other proteins in same PDB: d4y8wa2, d4y8wb2, d4y8wc2
    automated match to d2vn0a_
    complexed with hem, so4, str

Details for d4y8wb1

PDB Entry: 4y8w (more details), 2.64 Å

PDB Description: crystal structure of human cytochrome p450 21a2 progesterone complex
PDB Compounds: (B:) Cytochrome P450 21-hydroxylase

SCOPe Domain Sequences for d4y8wb1:

Sequence, based on SEQRES records: (download)

>d4y8wb1 a.104.1.0 (B:30-484) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpplapgflhllqpdlpiyllgltqkfgpiyrlhlglqdvvvlnskrtieeamvkkwadf
agrpepltyklvsrnypdlslgdysllwkahkkltrsalllgirdsmepvveqltqefce
rmraqpgtpvaieeefslltcsiicyltfgdkikddnlmpayykciqevlktwshwsiqi
vdvipflrffpnpglrrlkqaiekrdhivemqlrqhkeslvagqwrdmmdymlqgvaqps
meegsgqlleghvhmaavdlliggtettantlswavvfllhhpeiqqrlqeeldhelgpg
asssrvpykdrarlpllnatiaevlrlrpvvplalphrttrpssisgydipegtviipnl
qgahldetvwerphefwpdrflepgknsralafgcgarvclgeplarlelfvvltrllqa
ftllpsgdalpslqplphcsvilkmqpfqvrlqpr

Sequence, based on observed residues (ATOM records): (download)

>d4y8wb1 a.104.1.0 (B:30-484) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpplapgflhllqpdlpiyllgltqkfgpiyrlhlglqdvvvlnskrtieeamvkkwadf
agrpepltyklvsrnypdlslgdysllwkahkkltrsalllgirdsmepvveqltqefce
rmraqpgtpvaieeefslltcsiicyltfgdkikddnlmpayykciqevlktwshwsiqi
vdvipflrffpnpglrrlkqaiekrdhivemqlrqhkeslvagqwrdmmdymlqgvaqql
leghvhmaavdlliggtettantlswavvfllhhpeiqqrlqeeldhsrvpykdrarlpl
lnatiaevlrlrpvvplalphrttrpssisgydipegtviipnlqgahldetvwerphef
wpdrflepgknsralafgcgarvclgeplarlelfvvltrllqaftllpsgdalpslqpl
phcsvilkmqpfqvrlqpr

SCOPe Domain Coordinates for d4y8wb1:

Click to download the PDB-style file with coordinates for d4y8wb1.
(The format of our PDB-style files is described here.)

Timeline for d4y8wb1:

  • d4y8wb1 first appeared in SCOPe 2.05, called d4y8wb_