| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
| Family c.66.1.1: COMT-like [53336] (4 proteins) |
| Protein Catechol O-methyltransferase, COMT [53337] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [267759] (12 PDB entries) |
| Domain d4xuda_: 4xud A: [271580] automated match to d3bwma_ complexed with 43h, mes, mg, sam |
PDB Entry: 4xud (more details), 2.4 Å
SCOPe Domain Sequences for d4xuda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xuda_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Human (Homo sapiens) [TaxId: 9606]}
nllagdtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkivdaviqeh
qpsvllelgaycgysavrmarllspgarlitieinpdcaaitqrmvdfagvkdkvtlvvg
asqdiipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgap
dflahvrgsscfecthyqsfleyrevvdglekaiykgp
Timeline for d4xuda_: