Lineage for d4xuda_ (4xud A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892671Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2892682Protein Catechol O-methyltransferase, COMT [53337] (2 species)
  7. 2892683Species Human (Homo sapiens) [TaxId:9606] [267759] (12 PDB entries)
  8. 2892697Domain d4xuda_: 4xud A: [271580]
    automated match to d3bwma_
    complexed with 43h, mes, mg, sam

Details for d4xuda_

PDB Entry: 4xud (more details), 2.4 Å

PDB Description: synthesis and evaluation of heterocyclic catechol mimics as inhibitors of catechol-o-methyltransferase (comt): structure with cmpd32 ([1- (biphenyl-3-yl)-5-hydroxy-4-oxo-1,4-dihydropyridin-3-yl]boronic acid)
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d4xuda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xuda_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Human (Homo sapiens) [TaxId: 9606]}
nllagdtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkivdaviqeh
qpsvllelgaycgysavrmarllspgarlitieinpdcaaitqrmvdfagvkdkvtlvvg
asqdiipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgap
dflahvrgsscfecthyqsfleyrevvdglekaiykgp

SCOPe Domain Coordinates for d4xuda_:

Click to download the PDB-style file with coordinates for d4xuda_.
(The format of our PDB-style files is described here.)

Timeline for d4xuda_: