SCOPe 2.05: Domain d2np1b_: 2np1 B:

Lineage for d2np1b_ (2np1 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Nitrophorin 1 [50841] (1 species)

7. Species Rhodnius prolixus [TaxId:13249] [50842] (6 PDB entries)

8. Domain d2np1b_: 2np1 B: [27158]
   complexed with 2hp, hem, nh4

Details for d2np1b_

PDB Entry: 2np1, 2 Å

PDB Description: crystal structure of nitrophorin 1 from rhodnius prolixus

PDB Compounds: (B:) nitrophorin 1

SCOPe Domain Sequences for d2np1b_:

Sequence; same for both SEQRES and ATOM records:

>d2np1b_ b.60.1.1 (B:) Nitrophorin 1 {Rhodnius prolixus [TaxId: 13249]}
kctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslks
lltk

Timeline for d2np1b_:

• d2np1b_ first appeared (with stable ids) in SCOP 1.55
  
• d2np1b_ appears in SCOPe 2.04
  
• d2np1b_ appears in SCOPe 2.06
  
• d2np1b_ appears in the current release, SCOPe 2.08