Lineage for d4xuca_ (4xuc A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145091Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2145102Protein Catechol O-methyltransferase, COMT [53337] (2 species)
  7. 2145103Species Human (Homo sapiens) [TaxId:9606] [267759] (10 PDB entries)
  8. 2145109Domain d4xuca_: 4xuc A: [271579]
    automated match to d3bwma_
    complexed with 43g, mes, mg, sam

Details for d4xuca_

PDB Entry: 4xuc (more details), 1.8 Å

PDB Description: synthesis and evaluation of heterocyclic catechol mimics as inhibitors of catechol-o-methyltransferase (comt): structure with cmpd18 (1- (biphenyl-3-yl)-3-hydroxypyridin-4(1h)-one)
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d4xuca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xuca_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Human (Homo sapiens) [TaxId: 9606]}
nllagdtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkivdaviqeh
qpsvllelgaycgysavrmarllspgarlitieinpdcaaitqrmvdfagvkdkvtlvvg
asqdiipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgap
dflahvrgsscfecthyqsfleyrevvdglekaiykgp

SCOPe Domain Coordinates for d4xuca_:

Click to download the PDB-style file with coordinates for d4xuca_.
(The format of our PDB-style files is described here.)

Timeline for d4xuca_: