SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3wxwl_ (3wxw L:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (20 species)
    not a true protein
  7. 2020203Species Mouse (Mus musculus) [TaxId:10090] [186842] (147 PDB entries)
  8. 2020408Domain d3wxwl_: 3wxw L: [271576]
    automated match to d1kira_
    complexed with zn

Details for d3wxwl_

PDB Entry: 3wxw (more details), 2.4 Å

PDB Description: crystal structure of the human adiponectin receptor 2
PDB Compounds: (L:) V region light chain

SCOPe Domain Sequences for d3wxwl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wxwl_ b.1.1.1 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspaslsasvgetvtitcrasgnihnflawyqqkqgkspqvlvynaktladgvps
rfsgsgsgtqyslkinslqpedfgsyycqqfwstpytfgggtklein

SCOPe Domain Coordinates for d3wxwl_:

Click to download the PDB-style file with coordinates for d3wxwl_.
(The format of our PDB-style files is described here.)

Timeline for d3wxwl_: