Lineage for d4xe4a_ (4xe4 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2058159Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2058160Protein automated matches [190438] (24 species)
    not a true protein
  7. 2058190Species Human (Homo sapiens) [TaxId:9606] [187421] (73 PDB entries)
  8. 2058247Domain d4xe4a_: 4xe4 A: [271575]
    automated match to d1y59t_
    complexed with gol, nag

Details for d4xe4a_

PDB Entry: 4xe4 (more details), 2.4 Å

PDB Description: coagulation factor xii protease domain crystal structure
PDB Compounds: (A:) Coagulation factor XII

SCOPe Domain Sequences for d4xe4a_:

Sequence, based on SEQRES records: (download)

>d4xe4a_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
valrgahpyiaalywghsfcagsliapcwvltaahclqdrpapedltvvlgqerrnhsce
pcqtlavrsyrlheafspvsyqhdlallrlqedadgscallspyvqpvslpsgaarpset
tlcqvagwghqfegaeeyasflqeaqvpflslercsapdvhgssilpgmlcagfleggtd
acqgdsggplvcedqaaerrltlqgiiswgsgcgdrnkpgvytdvayylawirehtvs

Sequence, based on observed residues (ATOM records): (download)

>d4xe4a_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
valrgahpyiaalywghsfcagsliapcwvltaahclqdrpapedltvvlgqerrnhsce
pcqtlavrsyrlheafspvsyqhdlallrlqedadgscallspyvqpvslpsgaarpset
tlcqvagwghqfegaeeyasflqeaqvpflslercsapdvhgssilpgmlcagfledacq
gdsggplvcedqaaerrltlqgiiswgsrnkpgvytdvayylawirehtvs

SCOPe Domain Coordinates for d4xe4a_:

Click to download the PDB-style file with coordinates for d4xe4a_.
(The format of our PDB-style files is described here.)

Timeline for d4xe4a_: