SCOPe 2.05: Domain d3wxvl_: 3wxv L:

Lineage for d3wxvl_ (3wxv L:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (133 PDB entries)

8. Domain d3wxvl_: 3wxv L: [271573]
   automated match to d1kira_
   complexed with zn

Details for d3wxvl_

PDB Entry: 3wxv, 2.9 Å

PDB Description: crystal structure of the human adiponectin receptor 1

PDB Compounds: (L:) V region light chain

SCOPe Domain Sequences for d3wxvl_:

Sequence; same for both SEQRES and ATOM records:

>d3wxvl_ b.1.1.1 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspaslsasvgetvtitcrasgnihnflawyqqkqgkspqvlvynaktladgvps
rfsgsgsgtqyslkinslqpedfgsyycqqfwstpytfgggtklein

Timeline for d3wxvl_:

• d3wxvl_ is new in SCOPe 2.05-stable
  
• d3wxvl_ appears in SCOPe 2.06
  
• d3wxvl_ last appears in SCOPe 2.07