Lineage for d4xjkj_ (4xjk J:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733398Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1733618Protein automated matches [190132] (4 species)
    not a true protein
  7. 1733621Species Human (Homo sapiens) [TaxId:9606] [187203] (35 PDB entries)
  8. 1733681Domain d4xjkj_: 4xjk J: [271571]
    Other proteins in same PDB: d4xjka_, d4xjkc_, d4xjke_, d4xjkg_, d4xjki_
    automated match to d4ggfl_
    complexed with ca, mn, na

Details for d4xjkj_

PDB Entry: 4xjk (more details), 1.76 Å

PDB Description: crystal structure of mn(ii) ca(ii) na(i) bound calprotectin
PDB Compounds: (J:) Protein S100-A9

SCOPe Domain Sequences for d4xjkj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xjkj_ a.39.1.2 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
edldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglge

SCOPe Domain Coordinates for d4xjkj_:

Click to download the PDB-style file with coordinates for d4xjkj_.
(The format of our PDB-style files is described here.)

Timeline for d4xjkj_: