Lineage for d4xjkg_ (4xjk G:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733398Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1733399Protein Calcyclin (S100) [47479] (17 species)
  7. 1733456Species Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId:9606] [47487] (4 PDB entries)
    Migration inhibitory factor-related protein 8
  8. 1733472Domain d4xjkg_: 4xjk G: [271568]
    Other proteins in same PDB: d4xjkb_, d4xjkd_, d4xjkf_, d4xjkh_, d4xjkj_
    automated match to d1xk4a1
    complexed with ca, mn, na

Details for d4xjkg_

PDB Entry: 4xjk (more details), 1.76 Å

PDB Description: crystal structure of mn(ii) ca(ii) na(i) bound calprotectin
PDB Compounds: (G:) Protein S100-A8

SCOPe Domain Sequences for d4xjkg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xjkg_ a.39.1.2 (G:) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}
mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
ntdgavnfqeflilvikmgvaahkkshe

SCOPe Domain Coordinates for d4xjkg_:

Click to download the PDB-style file with coordinates for d4xjkg_.
(The format of our PDB-style files is described here.)

Timeline for d4xjkg_: