| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
| Protein automated matches [190132] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187203] (35 PDB entries) |
| Domain d4xjkf_: 4xjk F: [271567] Other proteins in same PDB: d4xjka_, d4xjkc_, d4xjke_, d4xjkg_, d4xjki_ automated match to d4ggfl_ complexed with ca, mn, na |
PDB Entry: 4xjk (more details), 1.76 Å
SCOPe Domain Sequences for d4xjkf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xjkf_ a.39.1.2 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
edldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglge
Timeline for d4xjkf_: