SCOPe 2.06: Domain d1np1a_: 1np1 A:

Lineage for d1np1a_ (1np1 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Nitrophorin 1 [50841] (1 species)

7. Species Rhodnius prolixus [TaxId:13249] [50842] (6 PDB entries)

8. Domain d1np1a_: 1np1 A: [27155]
   complexed with hem, hsm, po4

Details for d1np1a_

PDB Entry: 1np1, 2 Å

PDB Description: crystal structure of the complex of nitrophorin 1 from rhodnius prolixus with histamine

PDB Compounds: (A:) nitrophorin 1

SCOPe Domain Sequences for d1np1a_:

Sequence; same for both SEQRES and ATOM records:

>d1np1a_ b.60.1.1 (A:) Nitrophorin 1 {Rhodnius prolixus [TaxId: 13249]}
kctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslks
lltk

Timeline for d1np1a_:

• d1np1a_ first appeared (with stable ids) in SCOP 1.55
  
• d1np1a_ appears in SCOPe 2.05
  
• d1np1a_ appears in SCOPe 2.07
  
• d1np1a_ appears in the current release, SCOPe 2.08