Lineage for d4weue_ (4weu E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2744085Domain d4weue_: 4weu E: [271540]
    automated match to d3stbb_

Details for d4weue_

PDB Entry: 4weu (more details), 2.61 Å

PDB Description: co-complex structure of the f4 fimbrial adhesin faeg variant ad with llama single domain antibody v3
PDB Compounds: (E:) Anti-F4+ETEC bacteria VHH variable region

SCOPe Domain Sequences for d4weue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4weue_ b.1.1.1 (E:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlscaasgltfdtyamgwfrqapgkkreyvaaiswtgistyy
adiakgrftisrdnakntlylqmdslkpedtavyycaaqkslnvpapwdywgqgtqvtvs
s

SCOPe Domain Coordinates for d4weue_:

Click to download the PDB-style file with coordinates for d4weue_.
(The format of our PDB-style files is described here.)

Timeline for d4weue_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4weud_