SCOPe 2.07: Domain d4uyqb_: 4uyq B:

Lineage for d4uyqb_ (4uyq B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.139: Type I dockerin domain [63445] (1 superfamily)
   tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand

4. Superfamily a.139.1: Type I dockerin domain [63446] (2 families)

5. Family a.139.1.0: automated matches [191542] (1 protein)
   not a true family

6. Protein automated matches [190928] (7 species)
   not a true protein

7. Species Acetivibrio cellulolyticus [TaxId:35830] [271532] (6 PDB entries)

8. Domain d4uyqb_: 4uyq B: [271533]
   Other proteins in same PDB: d4uyqa1, d4uyqa2, d4uyqa3
   automated match to d4dh2d_
   complexed with ca; mutant

Details for d4uyqb_

PDB Entry: 4uyq, 1.81 Å

PDB Description: high resolution structure of the third cohesin scac in complex with the scab dockerin with a mutation in the c-terminal helix (in to si) from acetivibrio cellulolyticus displaying a type i interaction.

PDB Compounds: (B:) Cellulosomal scaffoldin adaptor protein B

SCOPe Domain Sequences for d4uyqb_:

Sequence; same for both SEQRES and ATOM records:

>d4uyqb_ a.139.1.0 (B:) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
kfiygdvdgngsvrindavlirdyvlgkinefpyeygmlaadvdgngsiksidavlvrdy
vlgkiflfpveek

Timeline for d4uyqb_:

• d4uyqb_ first appeared in SCOPe 2.05
  
• d4uyqb_ appears in SCOPe 2.06
  
• d4uyqb_ appears in the current release, SCOPe 2.08