![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.139: Type I dockerin domain [63445] (1 superfamily) tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand |
![]() | Superfamily a.139.1: Type I dockerin domain [63446] (2 families) ![]() |
![]() | Family a.139.1.0: automated matches [191542] (1 protein) not a true family |
![]() | Protein automated matches [190928] (7 species) not a true protein |
![]() | Species Acetivibrio cellulolyticus [TaxId:35830] [271532] (6 PDB entries) |
![]() | Domain d4uyqb_: 4uyq B: [271533] Other proteins in same PDB: d4uyqa1, d4uyqa2, d4uyqa3 automated match to d4dh2d_ complexed with ca; mutant |
PDB Entry: 4uyq (more details), 1.81 Å
SCOPe Domain Sequences for d4uyqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uyqb_ a.139.1.0 (B:) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]} kfiygdvdgngsvrindavlirdyvlgkinefpyeygmlaadvdgngsiksidavlvrdy vlgkiflfpveek
Timeline for d4uyqb_: