Class b: All beta proteins [48724] (178 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
Protein automated matches [191113] (12 species) not a true protein |
Species Acetivibrio cellulolyticus [TaxId:35830] [189869] (5 PDB entries) |
Domain d4uypc1: 4uyp C:2-143 [271531] Other proteins in same PDB: d4uypa2, d4uypa3, d4uypb_, d4uypc2, d4uypc3, d4uypd_ automated match to d4dh2a_ complexed with ca, epe, mpd, so4; mutant |
PDB Entry: 4uyp (more details), 1.49 Å
SCOPe Domain Sequences for d4uypc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uypc1 b.2.2.0 (C:2-143) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]} lqvdigstsgkagsvvsvpitftnvpksgiyalsfrtnfdpqkvtvasidagslienasd fttyynnengfasmtfeapvdrariidsdgvfatinfkvsdsakvgelynittnsaytsf yysgtdeiknvvyndgkievia
Timeline for d4uypc1: