Lineage for d4uypc1 (4uyp C:2-143)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377026Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2377160Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 2377161Protein automated matches [191113] (12 species)
    not a true protein
  7. 2377162Species Acetivibrio cellulolyticus [TaxId:35830] [189869] (5 PDB entries)
  8. 2377167Domain d4uypc1: 4uyp C:2-143 [271531]
    Other proteins in same PDB: d4uypa2, d4uypa3, d4uypb_, d4uypc2, d4uypc3, d4uypd_
    automated match to d4dh2a_
    complexed with ca, epe, mpd, so4; mutant

Details for d4uypc1

PDB Entry: 4uyp (more details), 1.49 Å

PDB Description: high resolution structure of the third cohesin scac in complex with the scab dockerin with a mutation in the n-terminal helix (in to si) from acetivibrio cellulolyticus displaying a type i interaction.
PDB Compounds: (C:) cellulosomal scaffoldin anchoring protein c

SCOPe Domain Sequences for d4uypc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uypc1 b.2.2.0 (C:2-143) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
lqvdigstsgkagsvvsvpitftnvpksgiyalsfrtnfdpqkvtvasidagslienasd
fttyynnengfasmtfeapvdrariidsdgvfatinfkvsdsakvgelynittnsaytsf
yysgtdeiknvvyndgkievia

SCOPe Domain Coordinates for d4uypc1:

Click to download the PDB-style file with coordinates for d4uypc1.
(The format of our PDB-style files is described here.)

Timeline for d4uypc1: