SCOPe 2.05: Domain d4uypc_: 4uyp C:

Lineage for d4uypc_ (4uyp C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (6 species)
   not a true protein

7. Species Acetivibrio cellulolyticus [TaxId:35830] [189869] (5 PDB entries)

8. Domain d4uypc_: 4uyp C: [271531]
   automated match to d4dh2a_
   complexed with ca, epe, mpd, so4; mutant

Details for d4uypc_

PDB Entry: 4uyp, 1.49 Å

PDB Description: high resolution structure of the third cohesin scac in complex with the scab dockerin with a mutation in the n-terminal helix (in to si) from acetivibrio cellulolyticus displaying a type i interaction.

PDB Compounds: (C:) cellulosomal scaffoldin anchoring protein c

SCOPe Domain Sequences for d4uypc_:

Sequence; same for both SEQRES and ATOM records:

>d4uypc_ b.2.2.0 (C:) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
mlqvdigstsgkagsvvsvpitftnvpksgiyalsfrtnfdpqkvtvasidagslienas
dfttyynnengfasmtfeapvdrariidsdgvfatinfkvsdsakvgelynittnsayts
fyysgtdeiknvvyndgkievialeh

Timeline for d4uypc_:

• d4uypc_ is new in SCOPe 2.05-stable
  
• d4uypc_ is called d4uypc1 in SCOPe 2.06
  
• d4uypc_ appears in the current release, SCOPe 2.08, called d4uypc1