SCOPe 2.08: Domain d4uyqa1: 4uyq A:2-143

Lineage for d4uyqa1 (4uyq A:2-143)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (13 species)
   not a true protein

7. Species Acetivibrio cellulolyticus [TaxId:35830] [189869] (5 PDB entries)

8. Domain d4uyqa1: 4uyq A:2-143 [271530]
   Other proteins in same PDB: d4uyqa2, d4uyqa3, d4uyqb_
   automated match to d4dh2a_
   complexed with ca; mutant

Details for d4uyqa1

PDB Entry: 4uyq, 1.81 Å

PDB Description: high resolution structure of the third cohesin scac in complex with the scab dockerin with a mutation in the c-terminal helix (in to si) from acetivibrio cellulolyticus displaying a type i interaction.

PDB Compounds: (A:) cellulosomal scaffoldin anchoring protein c

SCOPe Domain Sequences for d4uyqa1:

Sequence; same for both SEQRES and ATOM records:

>d4uyqa1 b.2.2.0 (A:2-143) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
lqvdigstsgkagsvvsvpitftnvpksgiyalsfrtnfdpqkvtvasidagslienasd
fttyynnengfasmtfeapvdrariidsdgvfatinfkvsdsakvgelynittnsaytsf
yysgtdeiknvvyndgkievia

Timeline for d4uyqa1:

• d4uyqa1 first appeared in SCOPe 2.05, called d4uyqa_
  
• d4uyqa1 appears in SCOPe 2.07