Lineage for d4uwpb_ (4uwp B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1937671Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1937672Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1937673Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1937817Protein automated matches [190079] (9 species)
    not a true protein
  7. 1937853Species Klebsiella pneumoniae [TaxId:573] [271524] (5 PDB entries)
  8. 1937859Domain d4uwpb_: 4uwp B: [271528]
    automated match to d4ua4b_
    complexed with zn

Details for d4uwpb_

PDB Entry: 4uwp (more details), 1.7 Å

PDB Description: penta zn1 coordination. leu224 in vim-26 from klebsiella pneumoniae has implications for drug binding.
PDB Compounds: (B:) metallo-beta-lactamase vim-26

SCOPe Domain Sequences for d4uwpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uwpb_ d.157.1.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
eyptvneipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaeaegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsanvlyggcavlelsstsagnv
adadlaewptsveriqkhypeaevvipghglpggldllqhtanvvkahkn

SCOPe Domain Coordinates for d4uwpb_:

Click to download the PDB-style file with coordinates for d4uwpb_.
(The format of our PDB-style files is described here.)

Timeline for d4uwpb_: