Class b: All beta proteins [48724] (180 folds) |
Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily) barrel, open; n*=6, S*=10; greek-key |
Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) |
Family b.46.1.0: automated matches [227262] (1 protein) not a true family |
Protein automated matches [227053] (7 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [271467] (6 PDB entries) |
Domain d4ts4a2: 4ts4 A:204-308 [271512] Other proteins in same PDB: d4ts4a1 automated match to d2bw0a1 |
PDB Entry: 4ts4 (more details), 1.75 Å
SCOPe Domain Sequences for d4ts4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ts4a2 b.46.1.0 (A:204-308) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} qkkenskidwnqpaeaihnwirgndrvpgawaeidgksvsfygstllendhfssngqple ipgasraalvtknglvlfgndgkmllvknlqfedgkmipgsqyfk
Timeline for d4ts4a2: