SCOPe 2.05: Domain d4tt8a1: 4tt8 A:1-203

Lineage for d4tt8a1 (4tt8 A:1-203)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (2 families)

5. Family c.65.1.1: Formyltransferase [53329] (5 proteins)

6. Protein automated matches [227063] (2 species)
   not a true protein

7. Species Danio rerio [TaxId:7955] [271465] (6 PDB entries)

8. Domain d4tt8a1: 4tt8 A:1-203 [271509]
   Other proteins in same PDB: d4tt8a2
   automated match to d2bw0a2
   complexed with 6dd, btb

Details for d4tt8a1

PDB Entry: 4tt8, 2.3 Å

PDB Description: crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (wild-type) complex with 10-formyl-5,8-dideazafolate

PDB Compounds: (A:) 10-formyltetrahydrofolate dehydrogenase

SCOPe Domain Sequences for d4tt8a1:

Sequence; same for both SEQRES and ATOM records:

>d4tt8a1 c.65.1.1 (A:1-203) automated matches {Danio rerio [TaxId: 7955]}
mkiavigqslfgqevykelkneghmivgvftipdkdgkvdplaieaekdgvpvfkfprwr
lkgkaitevvdqykavgaelnvlpfcsqfipmevidhpkhgsiiyhpsllprhrgasain
wtlihgdkkggftvfwaddgldtgpillqrecdvepndnvnsiykrflfpegvkgmveav
rliatgkaprikqpeegatyeci

Timeline for d4tt8a1:

• d4tt8a1 is new in SCOPe 2.05-stable
  
• d4tt8a1 appears in SCOPe 2.06
  
• d4tt8a1 appears in the current release, SCOPe 2.08