![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.65: Formyltransferase [53327] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest |
![]() | Superfamily c.65.1: Formyltransferase [53328] (2 families) ![]() |
![]() | Family c.65.1.1: Formyltransferase [53329] (5 proteins) |
![]() | Protein automated matches [227063] (3 species) not a true protein |
![]() | Species Zebrafish (Danio rerio) [TaxId:7955] [271465] (6 PDB entries) |
![]() | Domain d4tt8a1: 4tt8 A:1-203 [271509] Other proteins in same PDB: d4tt8a2 automated match to d2bw0a2 complexed with 6dd, btb |
PDB Entry: 4tt8 (more details), 2.3 Å
SCOPe Domain Sequences for d4tt8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tt8a1 c.65.1.1 (A:1-203) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} mkiavigqslfgqevykelkneghmivgvftipdkdgkvdplaieaekdgvpvfkfprwr lkgkaitevvdqykavgaelnvlpfcsqfipmevidhpkhgsiiyhpsllprhrgasain wtlihgdkkggftvfwaddgldtgpillqrecdvepndnvnsiykrflfpegvkgmveav rliatgkaprikqpeegatyeci
Timeline for d4tt8a1: