Class a: All alpha proteins [46456] (289 folds) |
Fold a.64: Saposin-like [47861] (2 superfamilies) 5 helices; folded leaf, closed |
Superfamily a.64.2: Bacteriocin AS-48 [47869] (1 family) automatically mapped to Pfam PF09221 |
Family a.64.2.1: Bacteriocin AS-48 [47870] (2 proteins) |
Protein automated matches [271493] (1 species) not a true protein |
Species Enterococcus faecalis [TaxId:1351] [271494] (1 PDB entry) |
Domain d4rgda_: 4rgd A: [271496] automated match to d1o82a_ complexed with cit; mutant |
PDB Entry: 4rgd (more details), 1.2 Å
SCOPe Domain Sequences for d4rgda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rgda_ a.64.2.1 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]} makefgipaavaktvlnvveaggwvttivsiltavgsggksllaaagresikaylkkeik kkgkraviaw
Timeline for d4rgda_: