SCOPe 2.06: Domain d4rgda_: 4rgd A:

Lineage for d4rgda_ (4rgd A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.64: Saposin-like [47861] (2 superfamilies)
   5 helices; folded leaf, closed

4. Superfamily a.64.2: Bacteriocin AS-48 [47869] (1 family)
   automatically mapped to Pfam PF09221

5. Family a.64.2.1: Bacteriocin AS-48 [47870] (2 proteins)

6. Protein automated matches [271493] (1 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [271494] (1 PDB entry)

8. Domain d4rgda_: 4rgd A: [271496]
   automated match to d1o82a_
   complexed with cit; mutant

Details for d4rgda_

PDB Entry: 4rgd, 1.2 Å

PDB Description: the structure a as-48 g13k/l40k mutant

PDB Compounds: (A:) bacteriocin as-48

SCOPe Domain Sequences for d4rgda_:

Sequence; same for both SEQRES and ATOM records:

>d4rgda_ a.64.2.1 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]}
makefgipaavaktvlnvveaggwvttivsiltavgsggksllaaagresikaylkkeik
kkgkraviaw

Timeline for d4rgda_:

• d4rgda_ first appeared in SCOPe 2.05
  
• d4rgda_ appears in SCOPe 2.07
  
• d4rgda_ appears in the current release, SCOPe 2.08