Lineage for d4rgdb_ (4rgd B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330098Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 2330188Superfamily a.64.2: Bacteriocin AS-48 [47869] (1 family) (S)
    automatically mapped to Pfam PF09221
  5. 2330189Family a.64.2.1: Bacteriocin AS-48 [47870] (2 proteins)
  6. 2330203Protein automated matches [271493] (1 species)
    not a true protein
  7. 2330204Species Enterococcus faecalis [TaxId:1351] [271494] (1 PDB entry)
  8. 2330206Domain d4rgdb_: 4rgd B: [271495]
    automated match to d1o82a_
    complexed with cit; mutant

Details for d4rgdb_

PDB Entry: 4rgd (more details), 1.2 Å

PDB Description: the structure a as-48 g13k/l40k mutant
PDB Compounds: (B:) bacteriocin as-48

SCOPe Domain Sequences for d4rgdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rgdb_ a.64.2.1 (B:) automated matches {Enterococcus faecalis [TaxId: 1351]}
makefgipaavaktvlnvveaggwvttivsiltavgsggksllaaagresikaylkkeik
kkgkraviaw

SCOPe Domain Coordinates for d4rgdb_:

Click to download the PDB-style file with coordinates for d4rgdb_.
(The format of our PDB-style files is described here.)

Timeline for d4rgdb_: