Class b: All beta proteins [48724] (176 folds) |
Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily) barrel, open; n*=6, S*=10; greek-key |
Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) |
Family b.46.1.0: automated matches [227262] (1 protein) not a true family |
Protein automated matches [227053] (5 species) not a true protein |
Species Danio rerio [TaxId:7955] [271467] (6 PDB entries) |
Domain d4r8va2: 4r8v A:204-308 [271492] Other proteins in same PDB: d4r8va1 automated match to d2bw0a1 complexed with btb, fmt, peg |
PDB Entry: 4r8v (more details), 2.2 Å
SCOPe Domain Sequences for d4r8va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r8va2 b.46.1.0 (A:204-308) automated matches {Danio rerio [TaxId: 7955]} qkkenskidwnqpaeaihnwirgndrvpgawaeidgksvsfygstllendhfssngqple ipgasraalvtknglvlfgndgkmllvknlqfedgkmipgsqyfk
Timeline for d4r8va2: