SCOPe 2.08: Domain d4r4ud2: 4r4u D:116-285

Lineage for d4r4ud2 (4r4u D:116-285)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [257672] (3 PDB entries)

8. Domain d4r4ud2: 4r4u D:116-285 [271486]
   automated match to d1c8ua2
   complexed with coa, mla, na

Details for d4r4ud2

PDB Entry: 4r4u, 2.2 Å

PDB Description: crystal structure of acyl-coa thioesterase tesb from yersinia pestis in complex with coenzyme a

PDB Compounds: (D:) acyl-coa thioesterase II

SCOPe Domain Sequences for d4r4ud2:

Sequence, based on SEQRES records:

>d4r4ud2 d.38.1.0 (D:116-285) automated matches {Yersinia pestis [TaxId: 632]}
ehqntmpdvpppeglmsetdiarqfshlipekvrekfigpqpiemrpvkfhnplqgsvee
pnryvwfrangkmpddlrvhqyllgyasdfnflptalqphgigflepgmqiatidhsmwf
hrpfrlddwllyavestsasgargfvrgqiynregvlvastvqegvirlh

Sequence, based on observed residues (ATOM records):

>d4r4ud2 d.38.1.0 (D:116-285) automated matches {Yersinia pestis [TaxId: 632]}
ehqntmpdvpppeglmsetdiarqgpqpiemrpvkfhnplqgsveepnryvwfrangkmp
ddlrvhqyllgyasdfnflptalqphgigflepgmqiatidhsmwfhrpfrlddwllyav
estsasgargfvrgqiynregvlvastvqegvirlh

Timeline for d4r4ud2:

• d4r4ud2 first appeared in SCOPe 2.05
  
• d4r4ud2 appears in SCOPe 2.07